Helsinki City – centrum för näringslivet

Aura Kivilaakso

 
Brunnsgården, Helsingfors
Brunnsgården färdigställdes 1955 enligt arkitekten Pauli Salomaas planer. Bild: Sakari Kiuru, Helsingfors stadsmuseum.

Den miljö som byggts upp efter krigen representerar vår närhistoria. Trots detta är det inte alltid lätt att hitta information om byggnader från denna tid eftersom den ofta är splittrad – i arkiv, olika publikationer och hos dem som använder byggnaderna. Till följd av detta har Helsingfors stadsmuseum genomfört en inventering av byggnader i kärncentrum som färdigställts under åren 1945–1990 i syfte att tjäna näringslivet. Utgångspunkten var att samla information som stödjer arbetet för att skydda det nyare byggnadsarvet och som kan utnyttjas i olika projekt, till exempel vid planläggning och reparations- och ombyggnadsarbeten på byggnaderna.

De affärsbyggnader som färdigställdes under åren 1945–1990 är jämt placerade i olika delar av Helsingfors centrum. På kartan är inventeringsområdet markerat med rött. De byggnader som markerats med orange färg färdigställdes på 1950-talet, de violetta på 1960-talet, de gröna på 1970-talet och de ljusblå på 1980-talet. Bild: Helsingfors stadsmuseum, Johanna Björkman och Aura Kivilaakso.

Affärsbyggnader i Helsingfors färdigställdes under åren 1945–1990
De affärsbyggnader som färdigställdes under åren 1945–1990 är jämt placerade i olika delar av Helsingfors centrum. På kartan är inventeringsområdet markerat med rött. De byggnader som markerats med orange färg färdigställdes på 1950-talet, de violetta på 1960-talet, de gröna på 1970-talet och de ljusblå på 1980-talet. © Bild: Johanna Björkman och Aura Kivilaakso, Helsingfors stadsmuseum.

Vid inventeringen Helsinki City undersöktes byggnaderna grundligt och med fokus på olika faser i deras historia och fenomen i den omgivande världen som påverkat byggandet. Projektet avvek från traditionella byggnadsinventeringar eftersom man i mer fördjupad utsträckning än vanligt samlade in information om enskilda byggnader. Inventeringen utgör en behövlig sammanfattning av näringscentrumets unga byggnadsbestånd och den ökar informationen om bakgrunden för och värdet av byggnadsarvet i Helsingfors kärncentrum.

Nytt och progressivt

Helsingfors första detaljplanearkitekt Bertel Jung fastställde att näringscentrumet, det vill säga ”city”, är det centrumområde som byggdes enligt en modell för storstäder och där byggnaderna tjänade näringslivet.  Denna typ av utveckling var aktuell i Helsingfors redan i början av 1900-talet då näringscentrumet hade börjat formas i området Gloet. Huvudkontor för banker och bankirrörelser hade börjat samlats särskilt vid Alexandersgatan. Byggandet av centrum fortsatte under 1900-talet i enlighet med då gällande detaljplaner och byggnadsordningar, behov och tillgängliga resurser. Efter krigen byggdes centrum upp tomt- och kvartersvis. För nya byggnadsprojekt utarbetades ofta så kallade frimärksplaner.

Hotell Presidentti och Granithuset
Helsingfors näringscentrum började sprida sig till Kampen från slutet av 1950-talet. I förgrunden Hotell Presidentti (Jaakko Kontio, Kalle Räike och Seppo Kilpiä, 1980), Granithuset (Heikki och Kaija Siren, 1985) och längre bort Bilhuset (Eino Tuompo och Veli Valorinta, 1958). Bild: Sakari Kiuru, Helsingfors stadsmuseum.

På 1950-talet fanns nästan alla regionens kontors- och servicelokaler i Helsingfors centrum och stadsbilden började i omfattande utsträckning moderniseras. Arkitektoniska nyheter kom till Helsingfors särskilt via byggandet inom näringslivet. Det blev modernt att satsa på nya byggnadstekniker och -material i stället för på byggnaders monumentalitet. En pelarstomme rekommenderades som bärande konstruktion, varvid mellanväggarna kunde vara lätta konstruktioner och inomhusutrymmena flexibelt kunde ändras. Från 1950-talet ändrades fasaderna från horisontala till vertikala eller nätformiga. Lokaler längs gatan hade ofta enhetliga väggar vid skyltfönstren, som därmed sammanknöt affärslokalen och gaturummet. Även de inre delarna i ett kvarter togs allt oftare i effektivt bruk som handelspassager.

Helsingfors näringscentrum började sprida sig till Kampen från slutet av 1950-talet. I förgrunden Hotell Presidentti (Jaakko Kontio, Kalle Räike och Seppo Kilpiä, 1980), Granithuset (Heikki och Kaija Siren, 1985) och längre bort Bilhuset (Eino Tuompo och Veli Valorinta, 1958). Bild: Helsingfors stadsmuseum, Sakari Kiuru 2013.

På 1950-talet var det främst olika företag och samfund samt en andelshandel som lät bygga nya affärsbyggnader i centrum. Ett bra exempel på den tidens affärsbyggande är huset Brunnsgården som Helsingfors universitets studentkår (HUS) lät bygga på Brunnsgatan 10. I samband med detta gjordes en led för fotgängare genom kvarteret från Brunnsgatan till Gamla studenthuset. Projektet var HUS största ekonomiska satsning på 1950-talet och därmed var också avkastningsförväntningarna på de centralt belägna byggnaderna höga.  Brunnsgården, som planerades av arkitekten Pauli Salomaa, färdigställdes 1955.

Brunnsgården, Helsingfors
Brunnsgården färdigställdes 1955 enligt arkitekten Pauli Salomaas planer. När byggnaden uppfördes representerade den det moderna byggandet i fråga om både utseendet och många byggnadstekniska lösningar. Bild: Sakari Kiuru, Helsingfors stadsmuseum.

Tack vare sitt moderna och ljusa utseende urskilde sig Brunnsgården i miljön. På den sida som vette mot Brunnsgatan hade de enhetliga funktionalistiska bandfönsterytorna fått ge vika för en standardiserad fasad av glasrutor. De enhetliga ljusreklamer och elektroniska löpande nyhetstexter som hade fästs på fasaden vittnade om den nya tidsåldern. Helsingfors hade aldrig tidigare skådat något liknande som de rulltrappor som installerats på utsidan mot Brunnsgatan. Det centrala läget och de nyheter som byggnaden stoltserade med lockade framstående hyresgäster till Brunnsgården. Brunnsgården, som var betydligt mer storskalig än den övriga miljön, förändrade i hög grad gatubilden framför järnvägsstationen. Under följande årtionde, när City-centrumet stod färdigt, fick kolonnen av byggnader längs Brunnsgatan en enhetlig takhöjd.

Brunnsgården färdigställdes 1955 enligt arkitekten Pauli Salomaas planer. När byggnaden uppfördes representerade den det moderna byggandet både i fråga om utseendet och många byggnadstekniska lösningar. Bild: Helsingfors stadsmuseum, Sakari Kiuru.

Typiskt för Helsingfors centrum har varit att de lägsta våningarna i affärsbyggnader har fått en ny form till följd av olika ombyggnads- och utvidgningsprojekt. Till exempel inleddes ett nytt förnyelseprojekt av huset Brunnsgården (fi. Kaivotalo) i området kring gården Brunnsgården (fi. Kaivopiha) i och med planeringen av metron på 1970- och 1980-talen. Vid huset Brunnsgården på Brunnsgatan 10 byggdes en ingång till Järnvägstorgets metrostation, byggnadens lägre delar höjdes och en gårdsflygel mitt i kvarteret revs. I stället byggdes två nya affärsbyggnader och mitt i kvarteret skapades en ny, öppen plats med fontäner – Brunnsgården. Kosti Kuronen var arkitekt för projektet.

Centrumets karaktär förändras

Liknande riktlinjer för centrumbyggandet bibehölls under 1960-talet, som kallas för betongarkitekturens årtionde. Stadsstrukturen började splittras i och med att service, industri och kontorshus började flyttas mot utkanterna av staden. Kontorsarbetarna hölls emellertid precis som förut kvar i centrumområdet, och näringscentrumet började sprida sig till området runt Kampen. På 1960-talet byggdes fler affärsbyggnader i Helsingfors centrum än under något annat årtionde efter kriget. Exempelvis den södra ändan av Mannerheimvägen, där den gatubild som dominerats av lägre stenhus omvandlats till höga, raka rader av kontors- och affärsbyggnader, berättar om den efterkrigstida utvecklingen.

Södra ändan av Mannerheimvägen i början av 1970-talet
Södra ändan av Mannerheimvägen i början av 1970-talet. På högra sidan Mannerheimvägen 10, det vill säga Hotell Marski (Einari Teräsvirta, 1961) och Mannerheimvägen 8 (Pauli Salomaa, 1960). Längre bort Oy Wulff Ab:s verksamhetshus (Kurt Simberg, 1965). Bild: Jarno Peltonen, Helsingfors stadsmuseum

Södra ändan av Mannerheimvägen i början av 1970-talet. På högra sidan Mannerheimvägen 10, det vill säga Hotell Marski (Einari Teräsvirta, 1961) och Mannerheimvägen 8 (Pauli Salomaa, 1960). Längre bort Oy Wulff Ab:s verksamhetshus (Kurt Simberg, 1965). Bild: Helsingfors stadsmuseum, Jarno Peltonen.

År 1958 skrev tidningen Helsingin Sanomat om det affärshus som planerats på Mannerheimvägen 10 och som skulle ”snygga upp” Mannerheimvägens ansikte. I tidningsartikeln berättades om hotell- och affärshuset Marski som Alkos dotterbolag Oy Yhtyneet Ravintolat Ab hade låtit bygga. Enligt tidningen fanns det i centrum på gatans västra sida ”nästan enbart gammalmodiga, opraktiska byggnader”.

Yhtyneet Ravintolat rev det av bolaget ägda och år 1877 uppförda bostadshuset på Mannerheimvägen 10 genom att åberopa dess dåliga skick och improduktivitet och köpte ytterligare 945 m2 byggnadsrätt av staden så att den byggnadsrätt som tomten hade kunde överskridas. Efter en inbjudningstävling som ordnades våren 1958 fick arkitekten Einari Teräsvirta uppgiften att planera det hotell- och affärshus som skulle byggas vid Mannerheimvägen. Marski blev ett av de mest betydande arbetena under arkitektens karriär. Möblerna i hotell- och restaurangutrymmena planerades av Ilmari Tapiovaara, som Teräsvirta också konsulterade i andra frågor kring inredningen. Hotell Marski inledde sin affärsverksamhet i februari 1962.

M-klubi, som bedrev sin verksamhet i Hotell Marski, fick snabbt rykte om sig att vara den viktigaste händelseplatsen för finländsk politik. Ute på stan skämtade man att landet inte styrs från riksdagen utan från Marski. Förutom M-klubi verkade även Helsingfors Internationella Pressklubb, eller den så kallade Pressklubben, i byggnaden. Hotell Marski fungerade också som presscenter vid SALT-förhandlingarna mellan USA och Sovjetunionen 1969, vid OSSE-mötet 1973 och vid OSSE-toppmötet 1975.

Hotell- och affärshuset Marski på 1960-talet
Hotell- och affärshuset Marski var ett av de byggnadsprojekt som förändrade karaktären av Mannerheimvägens södra ända på 1960-talet. På bilden har fasaden ännu sitt ursprungliga utseende med tippfönster och djupare indrag vid första våningen än i nuläget. Bild: H.T. Lehmusto, Helsingfors stadsmuseum.

Byggandet av Hotell Marski förtäljer väl hur man från 1950-talet förnyade stadsstrukturen i Helsingfors kärncentrum för att maximera byggnadseffektiviteten. Centrum höll på att få en ny roll. Från 1960-talet blev den ekonomiska situationen bättre. Under 1970-talet stärktes områdescentrumens ställning, små specialaffärer och stenfotsbutiker dog ut i centrum och antalet kundbetjäningslokaler för restauranger, varuhus, klädbutiker och banker började öka i samma mån. På 1980-talet levde man i en tid av ekonomiskt uppsving och därmed ökade byggandet och fastighetsplacerare började intressera sig för Helsingfors centrum.

Hotell- och affärshuset Marski var ett av de byggnadsprojekt som förändrade karaktären av Mannerheimvägens södra ända på 1960-talet. På bilden har fasaden ännu sitt ursprungliga utseende med tippfönster och djupare indrag vid första våningen än i nuläget. Bild: Helsingfors stadsmuseum, H.T. Lehmusto.

Kapitalismens stad

Under den senare delen av 1900-talet har Helsingfors kärncentrum starkare än tidigare reflekterat effekterna av privat byggnadsverksamhet och fastighetsplacering. Till exempel började affärsbankerna till följd av reformen av bokföringslagen 1973 låta bygga lukrativa kontors- och affärsbyggnader, som rymde bankens egen filial, i centrum. Fenomenet orsakades av skattemyndighetens tolkning av den nya lagen, nämligen så att om bankens eget kontor verkade i en fastighet som banken ägde sågs hela fastigheten som bankens anläggningstillgång, inte som placeringstillgång. Höjningen av hyrorna i centrumområdet på 1970-talet gjorde bankernas fastighetsplaceringsverksamhet lönsammare än tidigare.

Köpcentret Forum, Helsingfors
Köpcentret Forum är ett bra exempel på 1980-tals affärshusarkitektur. På bilden syns ännu Kimmo Kaivantos skulptur ”Broar av silver” som avlägsnades från ljusschaktet i samband med ombyggnadsarbetena på 2010-talet. © Bild: Erik Rönnerberg, Helsingfors stadsmuseum.

På 1980-talet blev det vanligare att det byggdes stora, moderna köpcentrum. Ett imponerande exempel på detta är köpcentret Forum på tomten i hörnet av Mannerheimvägen och Simonsgatan. Forum förenade Konstsamfundets tomter, som omfattade ungefär halva kvarteret, till en funktionell helhet. Forum planerades av arkitektbyrån Arkkitehtitoimisto Kari Hyvärinen, Kaarlo Leppänen ja Jaakko Suihkonen. Köpcentret byggdes runt en stor ljushall som lystes upp av takprismor. Från ljushallen kunde man gå till affärslokalerna och genom byggnaden till Tuppens torg och Georgsgatan.

Köpcentret Forum är ett bra exempel på 1980-tals affärshusarkitektur. På bilden syns ännu Kimmo Kaivantos skulptur ”Broar av silver” som avlägsnades från ljusschaktet i samband med ombyggnadsarbetena på 2010-talet. Bild: Helsingfors stadsmuseum, Erik Rönnerberg.

Under den tiden förhöll man sig delvis motstridigt till planen för köpcentret Forum. Särskilt en del av den yngre generationen av arkitekter kritiserade den för att inte vara självständig och karaktärslös. Det faktum att tidningen Arkkitehti inte publicerade en presentation av köpcentret är delvis ett tecken på denna attityd. I dagens läge anses Forum med sina högklassiga material och fungerande bottenlösningar dock vara ett bra exempel på 1980-tals affärshusarkitektur. Det krävdes att köpcentrum är flexibla för omvandlingar och möjliga att anpassa, vilket i Forum syns som glasväggar genom vilka man enkelt ändrar om affärslokalerna och den ringa mängden fasta konstruktioner. Man hade som utgångspunkt att lokalerna ständigt kommer att ändras. Golvytan av vit marmor framhävde den enhetliga helheten.

År 2012 inleddes ett omfattande projekt för ombyggnad och utvidgning av köpcentret som krävde att detaljplanen ändrades. I samband med det utvidgades köpcentret med affärslokaler bland annat i nivå med Tuppens torg och i lager- och parkeringslokalerna. Restauranglokalerna flyttades till Tuppens torg som samtidigt täcktes mer än tidigare. I samband med ändringen av detaljplanen skyddades bland annat byggnadens fasader mot Simonsgatan och Mannerheimvägen, ingångarna, glashörnet och dess entré samt grundformerna i yttertaket mot gatusidan.

Arvet från modernismen

Helsingfors centrum präglas av en miljö som byggts i skikt både ur tidsmässigt och visuellt perspektiv. Detta byggande i skikt beror i stor utsträckning på de modernistiska stadsplaneringsidealen som i Helsingfors genomfördes endast i små bitar. Efter detaljplanerna för Helsingfors från 1800-talet har det i kärncentrum endast gjorts tomtspecifika detaljplaner, och till följd av detta gäller planerna från 1800-talet fortsättningsvis för en del av tomterna i centrumområdet. Likaså har de planer som utarbetats för Helsingfors stadsstruktur under 1900-talet och resultatet från detaljplanetävlingarna för centrumområdet endast delvis överförts till planerna. Också Helsingfors stadsmuseums inventering intygar detta i och med att de affärsbyggnader som uppförts 1945–1990 är jämt placerade över olika delar av centrum.

De inventerade byggnaderna omfattar såväl några mer kända byggnader som fått status som monument som ett stort antal mer anonyma objekt som representerar vanlig vardagsarkitektur. Vid uppskattningen av värdet på sådana objekt har behovet av att motivera värdet fått en central roll – enbart åldern räcker inte för att fastställa en byggnads värde. Värdefulla egenskaper hos ett objekt kan vara till exempel byggnadsteknik och val av material, men även immateriella värden i anknytning till byggnaden, till exempel de fenomen som utgör bakgrunden för byggandet eller hur byggnaden anknyter till en större historisk händelsekedja. Det är särskilt viktigt att identifiera de immateriella värdena i de fall där byggnaden har genomgått stora förändringar. I fråga om affärsbyggnader i Helsingfors centrum tyder till exempel igenbyggandet av många ursprungligen öppna innergårdar på förändringar i användarnas och affärsverksamhetens behov.

När man granskar ett näringscentrum djupare under ytan öppnas en historia av strävanden, idéer och aktörer i bakgrunden för byggandet av staden upp framför oss. Inventeringen Helsinki City stärker också uppfattningen om att objekt som representerar vår närhistoria också kan ha ett stort kulturhistoriskt värde. Under ytan av centrumets mångformiga stadsbild finns många historier, värden och idéer som utgör en bakgrund till byggandet.

Källor

Kervanto Nevanlinna, Anja 2012. Voimat jotka rakensivat Helsinkiä 1945–2010. Helsingin historia vuodesta 1945, osa 4. Helsingfors: Förlagsaktiebolaget Otava .

Kivilaakso, Aura 2014. Kun Helsinkiin rakennettiin City. Keskustan vuosina 1945–1990 valmistuneet liikerakennukset. Helsingfors: Helsingfors stadsmuseum.

Makkonen, Leena 2012. Modernismia Helsingissä. Helsingfors stad: Stadsplaneringskontoret.

Publicerad 9.1.2018 kl. 13.49, uppdaterad 10.9.2018 kl. 11.11